PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 1385aa    MW: 150064 Da    PI: 4.4573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631530.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
   XP_009631530.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.22.4e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
   XP_009631530.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001673.23E-121053No hitNo description
PfamPF139216.5E-131070No hitNo description
SuperFamilySSF466891.04E-2033107IPR009057Homeodomain-like
CDDcd116596.07E-3155106No hitNo description
Gene3DG3DSA:1.10.10.605.1E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118316.7E-58406648IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1385 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYDPNDDPR  120
KLKPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDARQR KRKRRGIDYN AEIPFEKKPP PGFYDVAEED RPVEQPKFPT  240
TIEELEGERR VDKEARLRKQ DIARNKIAER QDAPTAILHA NKLNDPEAVR KRSKLNLPAP  300
QIPDHELEAI AKIGIASDLL GGDELSEGNA ATRALLANYA QTPQHAMTPM RTPQRTPSTK  360
QDAIMMEAEN QRRLTQSQTP LLGGDNPMLH PSDFSGVTPK KREVQTPNPL LTPSATPGAT  420
GLTPRIGMTP SRDSYGMTPK GTPMRDELRI NEEMDMHNNA KLGQFNSKKE LLSGLKSLPQ  480
PKNEYQIVVQ QPQEEIEEPP EEKIEEDMSD RIAREKAEEE ARQQALLRKR SKVLQRELPR  540
PPIASLELIR SSLMRADEDK SSFVPPTLIE QADEMIRKEL LSLLEHDNSK YPLDEKAEKE  600
KKKGVKRKVV AEPAIEDFEE DELKEADGLI KDEAQFVRVA MGHEGESLDE FVEAHKTTLN  660
DIMYFPTRNA YGLSSVAGNM EKLAALQNEF ENVKKKMDDD TKKATKLEQK IKVLTNGYQM  720
RAGKLWSQIE ATFKQMDTAG TELECFRALQ KQEQLAASHR INNLWEEVQK QKELERTLQK  780
RYGDLIADKE KMQHLMDEYR IQAQMQEEIA AKNRALELGK AEMEEKQSTS AATEAGVESS  840
GTGQCSNAEE TSASAAHVSS SAIEADDVPV ESSETGQCSN AEEKSASAAH VSSSAIEADD  900
VPVESSETGQ CSNAEEKSAS AAHVSSSAIE ADDVPVESSE TGQCSNAEEK SASAAHVSSS  960
AIEADDVPVE SSETGQCSNA EEKSASAAHV SSSAIEADDV PVESSETGQC SNAEEKSASA  1020
AHVSSSAIEA DDVPVESSET GQCSNAEEKS ASAPHVSSSA IEADGVPVES SETGQCSNAE  1080
EKSASAPHVS SSAIEADGVP VESSETGQCS NAEEKSASAP HVSSSAIEAD GVPVESSETG  1140
QCSNAEEKSA SAPHVSSSAI EADGVPVESS ETGQCSNAEE KSASAPHVSS SAIEADGVPV  1200
ESSETGQCSN AEEKSASAPH VSSSAIEADG VPVESSETGQ CSNAEEKSAS APHVSSSAIE  1260
ADGVPVESSE TGQCSNAEEK SASAPHVSSS AIEADDVPVE SSETGQCSNA EEKSASATHD  1320
ATPQDVEEQV KVISDDSTMD AEAMSENVPM EGQNCIGESN QDVTKTEDSG VADDAQDVVA  1380
SDAGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDARQRKRKRR
2198204QRKRKRR
3199204RKRKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0954960.0EU095496.1 Solanum lycopersicum CDC5-like protein (cdc5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631530.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLK4BPF00.0K4BPF0_SOLLC; Uncharacterized protein
STRINGSolyc04g009950.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61392431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5